PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen09g031360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CPP
Protein Properties Length: 825aa    MW: 89096.6 Da    PI: 5.8784
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen09g031360.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.9e-16522560240
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        +k+CnCkkskClk+YCeCfaag++C e C C+dC+Nk 
  Sopen09g031360.1 522 ACKRCNCKKSKCLKLYCECFAAGVYCVEPCACQDCFNKP 560
                       589**********************************96 PP

2TCR512.8e-16607645139
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Sopen09g031360.1 607 RHKRGCNCKKSGCLKKYCECYQGGVGCSINCRCEGCKNA 645
                       589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.7E-17521562IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.557522647IPR005172CRC domain
PfamPF036381.0E-11524559IPR005172CRC domain
SMARTSM011147.5E-18607648IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.1E-12609645IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 825 aa     Download sequence    Send to blast
MSKKEGENEK VSLESENVEV EVEGRKSEVS VKGEEGGGGG GGGVVVVMDT PERNKSQIAT  60
PISKFEESPF SNFLNNLSPI KPVKAAHFPQ TLNTLSFGSI PSVFTSPHVS SARESRFLRR  120
HLLSDPSKPE FASDNSAKVD NDEGMSDAVN SSNEPKESLG SQNSVVEASN ECSKLAVERT  180
LNYECNDSPS TLPTGSFRGK SLSEFAGSSV TYVPLVQGMS GKGLLRCEVN TEGKNELDPN  240
KEAPGCDWEN LICDATDLLI FDSPGDPEAF TKAAGPNLRH FGFASNEMQN MQAFGQASTS  300
ECGVDGSETE KPSTQPADET QVNEYAENQK MKPDSSLTND GIGVGQSERT DTEMVSTLYR  360
GMRRRCLVFE MVGSRRKHVD EGSGSSAVQD TDGNLACNEK QLVPYKAVSE SSRCILPGIG  420
LHLNALAASS KDGKVVKHET NASGKQLLIT PGSAVSLHPL VAGQESMSKS LPETSKEIVP  480
FENSVPLMED ASLAPGYVNN EELSQTSPKK KRRRLEPGEG EACKRCNCKK SKCLKLYCEC  540
FAAGVYCVEP CACQDCFNKP IHEDTVLATR KQIESRNPLA FAPKVIRNAD TISETGDDSS  600
KTPASARHKR GCNCKKSGCL KKYCECYQGG VGCSINCRCE GCKNAFGRKD GSVFIGTDGD  660
AEEEETDAYE KSTVDRASHK NLLHSDVELN PDSTVPATPL AFRRPPMQLP FSLKNKPPRS  720
SFLSIGSSSG IFAGQGVGRP DFFQPQPQPQ PKFEKPFESV KEDEMPEILQ QGGTSSPISG  780
IKTASPNRKR VSPPHCDFAN SPSRRSSRKL ILQSIPSFPS LTPNP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1507514PKKKRRRL
2508513KKKRRR
3510514KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015088205.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLK4CVM70.0K4CVM7_SOLLC; Uncharacterized protein
STRINGSolyc09g082500.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-164TESMIN/TSO1-like CXC 2